Rabbit Anti-IL18 binding protein Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-47241P

• Product Name:
• Rabbit Anti-IL18 binding protein Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human IL18 binding protein aa 113-194. Sequence: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRH VVLAQLWAGLRATLPPTQEALPSSHSSPQQQG Database link: O95998 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid