Rabbit Anti-IL18 binding protein Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-21077P

• Product Name:
• Rabbit Anti-IL18 binding protein Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human IL18 binding protein aa 70-120 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: TWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGST S

• Species Reactivity:
• Rat Predicted to work with: Mouse, Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid