Cat#:FPA-17431P;Product Name:Rabbit Anti-Glycerol kinase Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human Glycerol kinase aa 461-510. Sequence: TALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWK ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow;Isotype:IgG;Application:ICC/IF, ELISA, WB, IHC-P;Storage Buffer:Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS is without Mg2+, Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;