• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Goat Anti-Glycerol 3 Phosphate Dehydrogenase Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-17430P
  • Product Name:
  • Goat Anti-Glycerol 3 Phosphate Dehydrogenase Polyclonal Antibody
  • Host Species:
  • Goat
  • Immunogen:
  • Full length native protein (purified) corresponding to Rabbit Glycerol 3 Phosphate Dehydrogenase aa 1-349. (Purified from Rabbit Muscle). Sequence: MAGKKVCIVGSGDWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKL TEIINTHQENVKYLPGHKLPPNVVAVPDVVKAAADADILIFVVPHQFIGK ICDEI
  • Species Reactivity:
  • Rabbit Predicted to work with: Mouse, Rat, Cow, Human, Orangutan
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • pH: 7.2 Preservative: 0.01% Gentamicin sulphate Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride, 1% BSA Do not add sodium azide.
  • Storage Procedures:
  • Store at 4°C.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Goat Anti-Glycerol 3 Phosphate Dehydrogenase Polyclonal Antibody-FPA-17429P
  • Online Inquiry

    refresh