Rabbit Anti-GLTSCR1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46939P

• Product Name:
• Rabbit Anti-GLTSCR1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human GLTSCR1 aa 1278-1343. Sequence: ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTAL DPVHQPPPPPATLKVA Database link: Q9NZM4 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid