Rabbit Anti-GLTSCR1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-17213P

• Product Name:
• Rabbit Anti-GLTSCR1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse GLTSCR1 aa 1189-1238 (C terminal). The exact sequence is proprietary. NM_001081418. Sequence: FIQEEKTTLALDKQLAKEKPDEYVSSSRSLGFPVPVSSEGHRLPSHGQSS

• Species Reactivity:
• Mouse Predicted to work with: Rat, Chicken, Guinea pig, Cow, Cat, Dog, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid