Rabbit Anti-G gamma14 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-16104P

• Product Name:
• Rabbit Anti-G gamma14 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region within the internal sequence 19-68 ( KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS ) of Human G gamma14 (NP_113686).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid