Mouse Anti-G gamma14 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-16105P

• Product Name:
• Mouse Anti-G gamma14 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant full length protein corresponding to Human G gamma14 aa 1-69. Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFL KGIPEDKNPFKEKGGCLIS

• Species Reactivity:
• Human Predicted to work with: Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.2 Constituent: 100% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid