Rabbit Anti-C4orf33 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5810P

• Product Name:
• Rabbit Anti-C4orf33 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C terminal aa 127-176 ( PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF ) of Human C4orf33 (NP_001093253).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.