Cat#:FPA-5809P;Product Name:Rabbit Anti-C4orf32 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human C4orf32 aa 58-90. Sequence: NHTGEPVGDDYKKMGTLFGELNKNLINMGFTRM ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow;Isotype:IgG;Application:IHC-P;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;