Cat#:FPA-1728P;Product Name:Rabbit Anti-alpha COP I Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human alpha COP I aa 1174-1224 (C terminal). The exact sequence is proprietary. NP_004362.2. Sequence: RPIYRGKPVEKCPLSGACYSPEFKGQICRVTTVTEIGKDVIGLRISPLQF R ;Species Reactivity:Mouse, Human Predicted to work with: Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Pig, Xenopus laevis;Isotype:IgG;Application:WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-alpha COP I Polyclonal Antibody
Online Inquiry
Cat#:
FPA-1728P
Product Name:
Rabbit Anti-alpha COP I Polyclonal Antibody
Host Species:
Rabbit
Immunogen:
Synthetic peptide within Human alpha COP I aa 1174-1224 (C terminal). The exact sequence is proprietary. NP_004362.2. Sequence: RPIYRGKPVEKCPLSGACYSPEFKGQICRVTTVTEIGKDVIGLRISPLQF R
Species Reactivity:
Mouse, Human Predicted to work with: Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Pig, Xenopus laevis
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.