Rabbit Anti-alpha COP I Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-1726P

• Product Name:
• Rabbit Anti-alpha COP I Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within aa 22-71 ( PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD ) of Human alpha COP I (NP_004362).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Caenorhabditis elegans, Zebrafish

• Isotype:
• IgG

• Application:
• WB, IHC-P, ICC/IF

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid