Mouse Anti-SWI2 / SNF2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40613P

• Product Name:
• Mouse Anti-SWI2 / SNF2 Polyclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Fusion protein: SVVYEDSLELEKVVTKKYCEIMGDNSQLDFTEF , corresponding to C terminal aa 1635/1668 of Saccharomyces cerevisiae SWI2/ SNF2

• Species Reactivity:
• Saccharomyces cerevisiae

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid