• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-SWI2 / SNF2 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-40612P
  • Product Name:
  • Mouse Anti-SWI2 / SNF2 Polyclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Fusion protein: NIPQRQFSNEEVNRCYLRWQHLRNEHGMNAP , corresponding to N terminal aa 2/32 of Saccharomyces cerevisiae SWI2/ SNF2
  • Species Reactivity:
  • Saccharomyces cerevisiae
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituents: 50% Glycerol
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-SWAP70 Polyclonal Antibody-FPA-40611P
  • Online Inquiry

    refresh