Mouse Anti-S100 beta Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-18583M

• Product Name:
• Mouse Anti-S100 beta Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Full length native protein (purified) corresponding to Cow S100 beta AA 2-92. (Purified from bovine brain). Sequence: SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ EVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Cow

• Clone#:
• ROL243

• Isotype:
• IgG2a

• Application:
• IHC-P

• Positive control:
• Human melanoma tissue.

• Storage Buffer:
• Preservative: 0.05% Sodium azide Constituents: 0.05% BSA, 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid