• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-S100 beta Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-18581M
  • Product Name:
  • Mouse Anti-S100 beta Monoclonal Antibody
  • Host Species:
  • Mouse
  • Immunogen:
  • Full length native protein (purified) corresponding to Cow S100 beta AA 2-92. (Purified from bovine brain). Sequence: SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ EVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Rabbit, Cow
  • Clone#:
  • RG-A1
  • Isotype:
  • IgG1
  • Application:
  • IHC-P
  • Positive control:
  • Human melanoma tissue.
  • Storage Buffer:
  • Preservative: 0.05% Sodium azide Constituents: 0.05% BSA, 99% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Clonality:
  • Monoclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-S100 beta Monoclonal Antibody-FPA-18580M
  • Online Inquiry

    refresh