Mouse Anti-Rex1 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-18197M

• Product Name:
• Mouse Anti-Rex1 Monoclonal Antibody

• Host Species:
• Mouse

• Immunogen:
• Recombinant fragment corresponding to Human Rex1 AA 249-310. (Expressed in E.coli). Sequence: FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK

• Species Reactivity:
• Human

• Clone#:
• 4D11D6

• Isotype:
• IgG1

• Application:
• IHC-P, WB, Flow Cyt

• Positive control:
• Rex 1 recombinant protein; Rex1 (aa249-310) - hIgGFc transfected HEK293 cell lysate; Jurkat, Raji, HEK293 and PC-3 cell lysates; HEK293 cells; Human rectum cancer tissue; Human esophagus cancer tissue.

• Storage Buffer:
• Preservative: 0.05% Sodium azide Constituent: 99% PBS Contains 0.5% protein stabiliser.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid