Product finder
Cat#:FPA-18196M;Product Name:Mouse Anti-Rex1 Monoclonal Antibody;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human Rex1 AA 249-310. Sequence: FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK ;Species Reactivity:Mouse, Human;Clone#:4D11Z5;Isotype:IgG1;Application:WB, Flow Cyt, IHC-P;Positive control:Rex1 recombinant protein; Rex1 - hIgGFc transfected HEK293 cell lysate; NIH/3T3 cell lysate; HEK293 cells; lung cancer tissue; bladder cancer tissue.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS Contains 0.5% protein stabilizer.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;
Mouse Anti-Rex1 Monoclonal Antibody
Online Inquiry
- Product Name:
- Mouse Anti-Rex1 Monoclonal Antibody
- Immunogen:
- Recombinant fragment corresponding to Human Rex1 AA 249-310. Sequence: FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK
- Species Reactivity:
- Mouse, Human
- Application:
- WB, Flow Cyt, IHC-P
- Positive control:
- Rex1 recombinant protein; Rex1 - hIgGFc transfected HEK293 cell lysate; NIH/3T3 cell lysate; HEK293 cells; lung cancer tissue; bladder cancer tissue.
- Storage Buffer:
- Preservative: 0.05% Sodium azide Constituent: 99% PBS Contains 0.5% protein stabilizer.
- Storage Procedures:
- Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Pre product:Mouse Anti-REV3L Monoclonal Antibody-FPA-18195M
Next product:Mouse Anti-Rex1 Monoclonal Antibody-FPA-18197M