Cat#:FPA-5580M;Product Name:Mouse Anti-Chromogranin A Monoclonal Antibody;Formulation:According to the Swiss-Prot database, this protein has many different forms which correspond to various molecular weights; thus the possible variation from the predicted molecular weight of 51kDa.;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human Chromogranin A AA 19-457. Sequence: LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILS ILRHQNLLKE LQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAE LKEAVEEPSSKDVMEKREDSKE AEKSGEATDGARPQALPEPMQESKAE GNNQAPGEEEEEE;Species Reactivity:Human;Clone#:A-B14;Isotype:IgG1;Application:IHC-P, IP, IHC-Fr, Flow Cyt, ICC/IF, WB;Positive control:Adrenal gland, bowel, thyroid, pancreas, or pheochromocytoma.;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: PBS, 0.05% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;