Cat#:FPA-5579M;Product Name:Mouse Anti-Chromogranin A Monoclonal Antibody;Formulation:According to the Swiss-Prot database, this protein has many different forms which correspond to various molecular weights; thus the possible variation from the predicted molecular weight of 51kDa.;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human Chromogranin A AA 19-457. Sequence: LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILS ILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELK EAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQ APGEEEEEEEE;Species Reactivity:Human ;Clone#:A-B14;Isotype:IgG1;Application:Flow Cyt, ICC/IF, IHC-P;Positive control:Human pancreas, small cell lung carcinoma, adrenal gland, bowel, thyroid and pheochromocytoma tissues.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;