Cat#:FPA-905M;Product Name:Mouse Anti-AMPK gamma 1 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human AMPK gamma 1 AA 230-331. (Expressed in E.coli). Sequence: VVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKC YLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEK KP ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Clone#:6G2D8;Isotype:IgG1;Application:ICC/IF, Flow Cyt, IHC-P, WB;Positive control:Human AMPK gamma 1 (aa 230-331) recombinant protein; AMPK gamma 1 (aa: 230-331)-hIgGFc transfected HEK293 cell lysate; HepG2 cells, Human prostate cancer and kidney tissues;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;