Cat#:FPA-904M;Product Name:Mouse Anti-AMPK gamma 1 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human AMPK gamma 1 AA 230-331 (C terminal). Expressed in E. Coli. Sequence: VVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKC YLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEK KP ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Pig;Clone#:3Z1F8;Isotype:IgG1;Application:IHC-P, WB;Positive control:Human AMPK gamma 1 recombinant protein;HEK293 cell lysate, transfected with AMPK gamma 1 (amino acids 230-331)-IgGFc; Human cervical cancer and esophageal cancer tissues.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;