Rabbit Anti-TLR1 Polyclonal Antibody-Advanced Biomart

Cat#:FPA-41920P;Product Name:Rabbit Anti-TLR1 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide: LQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKV L conjugated to KLH, corresponding to aa 400-450 of Human TLR1. ;Species Reactivity:Human ;Isotype:IgG;Application:WB, Flow Cyt;Storage Buffer:Preservative: 0.05% Sodium Azide Constituents: 0.05% BSA, PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.;

Home > Products > Primary Antibodies >

Rabbit Anti-TLR1 Polyclonal Antibody Online Inquiry

Cat#:	FPA-41920P
Product Name:	Rabbit Anti-TLR1 Polyclonal Antibody
Formulation:	Liquid
Host Species:	Rabbit
Immunogen:	Synthetic peptide: LQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKV L conjugated to KLH, corresponding to aa 400-450 of Human TLR1.
Species Reactivity:	Human
Isotype:	IgG
Application:	WB, Flow Cyt
Storage Buffer:	Preservative: 0.05% Sodium Azide Constituents: 0.05% BSA, PBS
Storage Procedures:	Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.