Cat#:FPA-41919P;Product Name:Rabbit Anti-TLR1 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TLR1 aa 400-450 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: LQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKV L ;Species Reactivity:Mouse, Human Predicted to work with: Rat;Isotype:IgG;Application:WB, IHC-P, Flow Cyt;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: 99% PBS, 0.05% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;