Cat#:RPH-NP368;Product Name:Recombinant Human Vascular Cell Adhesion Protein 1 / VCAM-1 / CD106 / L1CAM Protein;Synonym:Vascular Cell Adhesion Protein 1, V-CAM 1, VCAM-1, INCAM-100, CD106, VCAM1, L1CAM;Description:Recombinant Human Vascular Cell Adhesion Protein 1 Protein is produced in Human Cells and the target gene encoding Phe25-Glu698 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGN EHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLK GDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQV YISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRME DSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRT QIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGG LVNGSSVTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGK ALVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKI LWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFP SESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKV GSQLRSLTLDVQGRENNKDYFSPEVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Vascular Cell Adhesion Protein 1/VCAM-1/CD106/L1CAM Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2, 5% Threhalose, pH 7.2.;Stability:Recombinant Human Vascular Cell Adhesion Protein 1/VCAM-1/CD106/L1CAM Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human VCAM1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human VCAM1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human VCAM1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;