• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human UDP-Glucose 4-Epimerase / GALE Protein Online Inquiry

  • Cat#:
  • RPH-NP367
  • Product Name:
  • Recombinant Human UDP-Glucose 4-Epimerase / GALE Protein
  • Synonym:
  • UDP-Glucose 4-Epimerase, Galactowaldenase, UDP-Galactose 4-Epimerase, GALE
  • Description:
  • Recombinant Human GALE Protein is produced in E.coli and the target gene encoding Met1-Ala348 is expressed with a His tag at the N-terminus.
  • Source:
  • E.coli
  • AA Sequence:
  • MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLT GTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQAD KTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRD YIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVA ACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein was supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 2mM DTT, 1mM EDTA, pH 8.0.
  • Stability:
  • Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human TWSG1 Protein I Advanced Biomart
  • Online Inquiry

    refresh