Cat#:RPH-NP367;Product Name:Recombinant Human UDP-Glucose 4-Epimerase / GALE Protein;Synonym:UDP-Glucose 4-Epimerase, Galactowaldenase, UDP-Galactose 4-Epimerase, GALE;Description:Recombinant Human GALE Protein is produced in E.coli and the target gene encoding Met1-Ala348 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLT GTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQAD KTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRD YIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVA ACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein was supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 2mM DTT, 1mM EDTA, pH 8.0.;Stability:Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein was supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 2mM DTT, 1mM EDTA, pH 8.0.
Stability:
Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human UDP-Glucose 4-Epimerase/GALE Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.