Cat#:RPH-NP335;Product Name:Recombinant Human RANK / TNFRSF11A / CD265 Protein;Synonym:CD265, ODFR, TNFRSF11A, TRANCE R, CD265, CD265 antigen, FEO, ODFROSTS, OFE, OPTB7, PDB2, RANK1, Receptor activator of NF-KB, receptor activator of nuclear factor-kappa B, TRANCER, tumor necrosis factor receptor superfamily member 11A;Description:Recombinant Human Receptor Activator of NF-kappa-B Protein is produced in Human Cells and the target gene encoding Ile30-Pro212 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDT GKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYF SDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human RANK/TNFRSF11A/CD265 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.;Stability:Recombinant Human RANK/TNFRSF11A/CD265 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human RANK protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human RANK protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human RANK protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;