Cat#:RPH-NP334;Product Name:Recombinant Human Pyruvate Kinase, Liver And RBC / PKLR Protein;Synonym:Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-Type/L-Type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PKLR, PK1, PKL;Description:Recombinant Human PKLR Protein is produced in Human Cells and the target gene encoding Met1-Ser574 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAM ADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAES IANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRG NANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVD LPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDE ILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSD VANAVLDGADCIMLSGETAKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVT AIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREP PEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSISVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein was supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 1mM DTT 0.2M NaCl, 10% glycerol, pH 8.0.;Stability:Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein was supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 1mM DTT 0.2M NaCl, 10% glycerol, pH 8.0.
Stability:
Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.