Cat#:RP-5150H;Product Name:Recombinant Human PON2 Protein;Synonym:Serum paraoxonase, arylesterase 2, EC 3.1.1.2, EC 3.1.8.1, PON 2, Serum aryldialkylphosphatase 2, A-esterase 2, Aromatic esterase 2.;Description:Paraoxonase-2 Protein is expressed in E. coli having a molecular weight of 43.5 kDa and fused to an amino terminal hexahistidine tag. The PON2 purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHT;Purity:Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.;Formulation:PON2 is supplied in PBS and 50% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;