Cat#:RP-5149H;Product Name:Recombinant Human PON1 Protein;Synonym:Serum paraoxonase, arylesterase 1, EC 3.1.1.2, EC 3.1.8.1, PON 1, Serum aryldialkylphosphatase 1, A-esterase 1, Aromatic esterase 1, K-45, ESA, PON.;Description:Paraoxonase-1 Isoform Protein is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag. The PON1 purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIE TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLE LGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQE EEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWEM YLGLAWSYVVYYSPSEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHV YEK;Purity:Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.;Formulation:PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;