Cat#:RP-4012H;Product Name:Recombinant Human IL1 beta Protein, HEK;Synonym:Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.;Description:Interleukin-1 beta Protein produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation. The IL-1 beta is purified by proprietary chromatographic techniques.;Source:HEK.;AA Sequence:APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP VALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFES AQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS.;Purity:Greater than 95% as obsereved by SDS-PAGE.;Bioactivity:The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml.;Formulation:The IL-1 beta was lyophilized from 1mg/ml in 1xPBS.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA.;Storage:Lyophilized?IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;