Cat#:RP-3974H;Product Name:Recombinant Human IFN a 2b Protein;Synonym:Interferon alpha 2b, IFNA, INFA2, MGC125764, MGC125765.;Description:Interferon-a 2b Protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 166 amino acids and having a molecular mass of 19400 Dalton. The Interferon-alpha 2b gene was obtained from human leukocytes. The IFN-a 2b is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLF STMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE.;Purity:Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Bioactivity:The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 260,000,000 IU/ mg.;Formulation:Lyophilized from a (1 mg/ml) solution in containing 2.3 mg Sodium phosphate dibasic and 0.55 mg sodium phosphate monobasic buffer.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Interferon-alpha 2b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized Interferon although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN alpha 2b should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;