Cat#:RP-3631H;Product Name:Recombinant Human HBsAg preS2;Synonym:HBsAg;Description:The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique.;Source:E.coli.;AA Sequence:MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.;Purity:Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Formulation:HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportion;