Cat#:RP-3630H;Product Name:Recombinant Human HBsAg preS1;Synonym:HBsAg;Description:The E.coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.;Source:E.coli;AA Sequence:MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGAN SNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSP QAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.;Purity:HBsAg Protein is Greater than 95% pure as determined by 10% PAGE (coomassie staining).;Formulation:HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportion;