Cat#:RP-3484H;Product Name:Recombinant Human GNLY Protein;Synonym:LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.;Description:GNLY Protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa. The GNLY is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYD LARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYR TCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWR DVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPS TGPLGSHHHHHH.;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Granulysin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;