Cat#:RPH-NP323;Product Name:Recombinant Human Polypeptide GalNac Transferase 3 / GALNT3 Protein;Synonym:Polypeptide N-acetylgalactosaminyltransferase 3, Polypeptide GalNAc transferase 3, GalNAc-T3, pp-GaNTase 3, Protein-UDP acetylgalactosaminyltransferase 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3, HFTC, HHS;Description:Recombinant Human GALNT3 Protein is produced in Human Cells and the target gene encoding Gln38-Asp633 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYY TAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPD TRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYL HDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAEN YTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTF AGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPK GTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNI YPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQ KELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSD PLQKWILSQNDVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Polypeptide GalNac Transferase 3/GALNT3 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.