Cat#:RP-2486H;Product Name:Recombinant Human CDH1 Protein, HEK;Synonym:Epithelial cadherin, E-cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324 antigen, CDH1, CDHE, UVO, ECAD, LCAM, Arc-1, CD324, Cadherin-E.;Description:E-Cadherin Protein produced in HEK cells is a secreted protein with the sequence of Human E-Cadherin (amino acids Asp155-Ile707) and fused to a 6xHis tag at the C-terminus.;Source:HEK cells.;AA Sequence:DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWL KVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVME GALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTG LDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVV ITTLKVTDADAPN;Purity:Greater than 95.0% as determined by SDS-PAGE.;Bioactivity:Please contact us for detailed information;Formulation:The CDH1 protein was lyophilized from a 0.2µm filtered solution in PBS, pH7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized CDH1 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized E-Cadherin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CDH1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;