• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human CD14 Protein, HEK Online Inquiry

  • Cat#:
  • RP-2411H
  • Product Name:
  • Recombinant Human CD14 Protein, HEK
  • Synonym:
  • Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.
  • Description:
  • CD14 Protein produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
  • Source:
  • HEK293 cells.
  • AA Sequence:
  • TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVD ADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKIT GTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAF SCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCA ALAAAGVQPHSLDLSHNSLRATVNPSAP
  • Purity:
  • Greater than 95% as determined by SDS-PAGE.
  • Formulation:
  • CD14 was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
  • Storage:
  • Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Human CD14 Protein, CHO-Advanced Biomart
  • Online Inquiry

    refresh