Cat#:RP-2265H;Product Name:Recombinant Human BNP Protein;Synonym:NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.;Description:B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4.;AA Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.;Purity:Greater than 95.0% as determined by RP-HPLC.;Formulation:The protein was lyophilized without additives.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;