• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human BNP Protein Online Inquiry

  • Cat#:
  • RP-2264H
  • Product Name:
  • Recombinant Human BNP Protein
  • Synonym:
  • NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
  • Description:
  • B-type Natriuretic Peptide Protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
  • Purity:
  • Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Formulation:
  • Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Storage:
  • Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Human BNIP1 Protein-Advanced Biomart
  • Online Inquiry

    refresh