• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human BAFF R Protein Online Inquiry

  • Cat#:
  • RP-2172H
  • Product Name:
  • Recombinant Human BAFF R Protein
  • Synonym:
  • TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
  • Description:
  • B Lymphocyte Stimulator Receptor Protein extracellular produced in E.coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa. The BAFF-R is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG ASSPAPRTALQPQESVGAGAGEAALPLPG.
  • Purity:
  • Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Bioactivity:
  • Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0µg/ml of human soluble BAFF.
  • Formulation:
  • Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Storage:
  • Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Human BAFF Protein, Plant-Advanced Biomart
  • Online Inquiry

    refresh