Cat#: | RPH-NP060 |
Product Name: | Recombinant Human C-C Motif Chemokine 26 / CCL26 Protein(27-94) |
Synonym: | C-C Motif Chemokine 26, CC Chemokine IMAC, Eotaxin-3, Macrophage Inflammatory Protein 4-Alpha, MIP-4-Alpha, Small-Inducible Cytokine A26, Thymic Stroma Chemokine-1, TSC-1, CCL26, SCYA26 |
Description: | Recombinant Human C-C Motif Chemokine 26 Protein is produced in E.coli and the target gene encoding Ser27-Leu94 is expressed. |
Source: | E.coli |
AA Sequence: | MSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKT PKQL |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin: | < 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Formulation: | Recombinant Human C-C Motif Chemokine 26/CCL26 Protein (27-94)was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
Stability: | Recombinant Human C-C Motif Chemokine 26/CCL26 Protein (27-94)is stable for up to 1 year from date of receipt at -70℃. |
Reconstitution: | Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Usage: | For Lab Research Use Only |
Storage: | Lyophilized recombinant human CCL26 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL26 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL26 protein samples are stable below -20°C for 3 months. |