Cat#:RPH-NP059;Product Name:Recombinant Human C-C Motif Chemokine 26 / CCL26 Protein(24-94);Synonym:C-C Motif Chemokine 26, CC Chemokine IMAC, Eotaxin-3, Macrophage Inflammatory Protein 4-Alpha, MIP-4-Alpha, Small-Inducible Cytokine A26, Thymic Stroma Chemokine-1, TSC-1, CCL26, SCYA26;Description:Recombinant Human C-C Motif Chemokine 26 Protein is produced in E.coli and the target gene encoding Thr24-Leu94 is expressed.;Source:E.coli;AA Sequence:MTRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISL LKTPKQL;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-C Motif Chemokine 26/CCL26 Protein (24-94)was supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM EDTA, 20% Glycerol, pH 9.0.;Stability:Recombinant Human C-C Motif Chemokine 26/CCL26 Protein (24-94)is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human CCL26 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;