Cat#: | RP-5090H |
Product Name: | Recombinant Human PLA2G2D Protein |
Synonym: | phospholipase A2 group IID; SPLASH; sPLA2S; PLA2IID; sPLA2-IID; group IID secretory phospholipase A2; GIID sPLA2; phosphatidylcholine 2-acylhydrolase 2D; secretory phospholipase A2s; secretory-type PLA, stroma-associated homolog |
Gene Introduction: | This gene encodes a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophospholipids and free fatty acid. This gene may be involved in inflammation and immune response, and in weight loss associated with chronic obstructive pulmonary disease. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2012] |
Description: | Secreted Phospholipase A2 IID / PLA2G2D Protein, produced in E.coli was fused with a His Tag at N-terminal. PLA2G2D protein has a molecular weight of 16.4 kDa containing 125 aa residues of the human secreted phospholipase A2-IID and 16 additional aa residues of His Tag. |
Source: | E.coli |
Predicted N Terminal: | His |
AA Sequence: | MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC. |
Molecular Characterization: | 16.4 kDa |
Formulation: | The recombinant human PLA2G2D protein was sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4. |
Stability: | Recombinant PLA2G2D Proteins are stable for up to 1 year from date of receipt at -70℃ |
Reconstitution: | Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. |
Host Species: | Human |
Storage: | Store the lyophilized PLA2G2D protein at -20℃. Reconstituted protein can be stored at 4℃ for 2 weeks. Aliquot the protein after reconstitution. Please avoid repeated freezing/thawing cycles. |
References: | Secretory phospholipase A2 group IID Is involved in progesterone-induced acrosomal exocytosis of human spermatozoa. Li K, et al. J Androl, 2012 Sep-Oct. PMID 22240557 |