Rabbit anti-Rat CD31/PECAM1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07461P

• Product Name:
• Rabbit anti-Rat CD31/PECAM1 Polyclonal Antibody

• Synonym:
• CD31; Pecam; CD31/PECAM1

• Description:
• The antibody against CD31/PECAM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 611-678 of rat CD31/PECAM1 (NP_113779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 611-678 of rat CD31/PECAM1 (NP_113779.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD31/PECAM1

• Form:
• Liquid

• Immunogen Species:
• Rat

• Immunogen Sequence:
• YFLRKAKAKQKPVEMSRPAVPLLNSNSEKVSEPSVETNSHYDSQNMDVEYTEVEVSSLEPHQENGRLP

• Gene ID:
• 29583

• Uniprot-ID:
• Q3SWT0

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, Mouse spleen, Mouse heart, Rat heart