Rabbit anti-Mouse S100A8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07460P

• Product Name:
• Rabbit anti-Mouse S100A8 Polyclonal Antibody

• Synonym:
• p8; B8Ag; CFAg; Caga; MRP8; CP-10; 60B8Ag; S100A8

• Description:
• The antibody against S100A8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of mouse S100A8 (NP_038678.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of mouse S100A8 (NP_038678.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• S100A8

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

• Gene ID:
• 20201

• Uniprot-ID:
• P27005

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, Mouse spleen, Rat spleen