Rabbit anti-Mouse WDR33 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05794P

• Product Name:
• Rabbit anti-Mouse WDR33 Polyclonal Antibody

• Synonym:
• WDC146; 1110001N06Rik; 2310011G05Rik; 2810021O11Rik; 8430413N20Rik; WDR33

• Description:
• The antibody against WDR33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of mouse WDR33 (NP_001164437.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of mouse WDR33 (NP_001164437.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• WDR33

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREA

• Gene ID:
• 74320

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Rat testis