Rabbit anti-Human HLA-E Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05795P

• Product Name:
• Rabbit anti-Human HLA-E Polyclonal Antibody

• Synonym:
• QA1; HLA-6.2; HLA-E

• Description:
• The antibody against HLA-E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-200 of human HLA-E (NP_005507.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-200 of human HLA-E (NP_005507.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HLA-E

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETL

• Gene ID:
• 3133

• Uniprot-ID:
• P13747

• Purification Method:
• Affinity purification

• Positive Samples:
• HL-60, SKOV3, Mouse liver, Rat liver