Rabbit anti-Mouse MED23 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06844P

• Product Name:
• Rabbit anti-Mouse MED23 Polyclonal Antibody

• Synonym:
• sno; Sur2; Crsp3; ESTM7; 130kDa; snouty; mKIAA1216; 3000002A17Rik; MED23

• Description:
• The antibody against MED23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 666-965 of mouse MED23 (NP_001159888.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 666-965 of mouse MED23 (NP_001159888.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MED23

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• GSSEVQPQFTRFLNDPKTVLSAESEELNRALILTLARATHVTDFFTGSDSIQGTWCKDILQTIMNFTPHNWASHTLSCFPAPLQAFFKQNNVPQESRFNLKKNVEEEYRKWKSMTDENEIITQFSVQGFPPLFLCLLWKMLLETDHISQIGYKVLERIGARALVAHVRTFADFLVYEFSTSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPEHWLQSDWHTKHMSYHKKYPEKLYFEGLAEQVDPPVPIQSPYLPIYF

• Gene ID:
• 70208

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, BT-474, HL-60, HeLa