Rabbit anti-Human HIST1H2BG Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06845P

• Product Name:
• Rabbit anti-Human HIST1H2BG Polyclonal Antibody

• Synonym:
• H2B/a; H2BC4; H2BC6; H2BC7; H2BFA; H2B.1A; H2BC10; HIST1H2BG; dJ221C16.8

• Description:
• The antibody against HIST1H2BG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human HIST1H2BG (P62807) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human HIST1H2BG (P62807).

• Species Reactivity:
• Human, Mouse, Rat, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HIST1H2BG

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Gene ID:
• 30178349

• Uniprot-ID:
• P62807

• Purification Method:
• Affinity purification

• Positive Samples:
• A-549, SKOV3, MCF7, HepG2, K-562, Rat small intestine